GTF2IRD1 Antibody - C-terminal region (ARP33735_T100)

Data Sheet
 
Product Number ARP33735_T100
Product Page www.avivasysbio.com/gtf2ird1-antibody-c-terminal-region-arp33735-t100.html
Name GTF2IRD1 Antibody - C-terminal region (ARP33735_T100)
Protein Size (# AA) 959 amino acids
Molecular Weight 106kDa
NCBI Gene Id 9569
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name GTF2I repeat domain containing 1
Alias Symbols BEN, WBS, GTF3, RBAP2, CREAM1, MUSTRD1, WBSCR11, WBSCR12, hMusTRD1alpha1
Peptide Sequence Synthetic peptide located within the following region: TFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tassabehji,M., (2005) Science 310 (5751), 1184-1187
Description of Target GTF2IRD1 contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. GTF2IRD1 is related to Williams-Beuren syndrome, a multisystem developmental disorder. Western blots using three different antibodies against three unique regions of this protein target confirm the same apparent molecular weight in our tests. The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing of this gene generates at least 2 transcript variants.
Protein Interactions UBC; SUMO2; USF1; HDAC3; SMAD2; EXOSC4; CDK20; PIAS2; SMAD3; NFI1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GTF2IRD1 (ARP33735_T100) antibody
Blocking Peptide For anti-GTF2IRD1 (ARP33735_T100) antibody is Catalog # AAP33735 (Previous Catalog # AAPP04801)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2IRD1
Uniprot ID Q9UHL9
Protein Name General transcription factor II-I repeat domain-containing protein 1
Protein Accession # NP_057412
Purification Protein A purified
Nucleotide Accession # NM_016328
Tested Species Reactivity Human
Gene Symbol GTF2IRD1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human kidney
Human kidney
Image 2
Transfected 293T
WB Suggested Anti-GTF2IRD1 Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com