RPS16 Antibody - middle region (ARP33536_T100)

Data Sheet
 
Product Number ARP33536_T100
Product Page www.avivasysbio.com/rps16-antibody-middle-region-arp33536-t100.html
Name RPS16 Antibody - middle region (ARP33536_T100)
Protein Size (# AA) 146 amino acids
Molecular Weight 44kDa
NCBI Gene Id 6217
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ribosomal protein S16
Alias Symbols S16
Peptide Sequence Synthetic peptide located within the following region: LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKKFGGPGARAC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yoshihama,M., et al., (2002) Genome Res. 12 (3), 379-390
Description of Target Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS16 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S9P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome
Protein Interactions HUWE1; UBC; TP53; CEP76; TUBGCP4; CEP250; CEP57; AURKB; TUBG1; CDKN1A; AURKA; ASB14; ASB15; ZBTB1; EED; WIBG; EIF2A; TSR1; EIF3L; RPS3; RPS2; RPS6; RPS5; RPS4X; RPS3A; RPSA; FAU; SND1; LARP1; GNB2L1; DYNLT3; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPS16 (ARP33536_T100) antibody
Blocking Peptide For anti-RPS16 (ARP33536_T100) antibody is Catalog # AAP33536 (Previous Catalog # AAPP04587)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RPS16
Uniprot ID Q8N7E9
Protein Name Spermatogenic leucine zipper protein 1
Protein Accession # NP_001011
Purification Protein A purified
Nucleotide Accession # NM_001020
Tested Species Reactivity Human
Gene Symbol RPS16
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-RPS16 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com