TEAD3 Antibody - middle region (ARP33429_P050)

• Product Number: ARP33429_P050
• Name: TEAD3 Antibody - middle region (ARP33429_P050)
• Protein Size (# AA): 435 amino acids
• Molecular Weight: 49kDa
• NCBI Gene Id: 7005
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: TEA domain family member 3
• Alias Symbols: TEF5, TEAD5, TEF-5, DTEF-1, ETFR-1, TEAD-3
• Peptide Sequence: Synthetic peptide located within the following region: GLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTIS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Peng,L., (2004) Mol. Endocrinol. 18 (8), 2049-2060
• Description of Target: TEAD3 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer.This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.
• Protein Interactions: VGLL2; YAP1; KIFC2; PIDD1; PHB2; AP4S1; UBC; SUMO2; WWTR1; VGLL1; CTBP2; MYH7; E2F3; E2F1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TEAD3 (ARP33429_P050) antibody is Catalog # AAP33429 (Previous Catalog # AAPP04475)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEAD3
• Uniprot ID: Q99594
• Protein Name: Transcriptional enhancer factor TEF-5
• Publications:

  Ribas, R. et al. Members of the TEAD family of transcription factors regulate the expression of Myf5 in ventral somitic compartments. Dev. Biol. 355, 372-80 (2011). 21527258

• Protein Accession #: NP_003205
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003214
• Tested Species Reactivity: Human
• Gene Symbol: TEAD3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Image 1: Human heart
  
  WB Suggested Anti-TEAD3 antibody Titration: 1 ug/mL
  Sample Type: Human heart
• Image 2: Human Placenta
  
  WB Suggested Anti-TEAD3 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Placenta