| Product Number |
ARP33410_P050 |
| Product Page |
www.avivasysbio.com/tcea3-antibody-middle-region-arp33410-p050.html |
| Name |
TCEA3 Antibody - middle region (ARP33410_P050) |
| Protein Size (# AA) |
348 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
6920 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transcription elongation factor A (SII), 3 |
| Alias Symbols |
TFIIS, TFIIS.H |
| Peptide Sequence |
Synthetic peptide located within the following region: KSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMAS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Labhart,P. (1998) Genomics 52 (3), 278-288 |
| Description of Target |
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human TCEA3 with an internal ID of P04456 |
| Protein Interactions |
RPH3AL; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TCEA3 (ARP33410_P050) antibody |
| Blocking Peptide |
For anti-TCEA3 (ARP33410_P050) antibody is Catalog # AAP33410 (Previous Catalog # AAPS03110) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TCEA3 |
| Uniprot ID |
O75764 |
| Protein Name |
Transcription elongation factor A protein 3 |
| Protein Accession # |
NP_003187 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003196 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TCEA3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 100%; Rat: 92% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TCEA3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
