| Product Number |
ARP33382_P050 |
| Product Page |
www.avivasysbio.com/zfp36l1-antibody-n-terminal-region-arp33382-p050.html |
| Name |
ZFP36L1 Antibody - N-terminal region (ARP33382_P050) |
| Protein Size (# AA) |
338 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
677 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 36, C3H type-like 1 |
| Alias Symbols |
BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B |
| Peptide Sequence |
Synthetic peptide located within the following region: QLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Blackshear,P.J., et al., (2003) Prog. Nucleic Acid Res. Mol. Biol. 75, 43-68 |
| Description of Target |
ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. |
| Protein Interactions |
MAPK14; MAPKAPK2; YWHAB; UBC; AKT1; RBM8A; ACD; TINF2; POT1; TERF1; ELAVL1; PAFAH1B2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZFP36L1 (ARP33382_P050) antibody |
| Blocking Peptide |
For anti-ZFP36L1 (ARP33382_P050) antibody is Catalog # AAP33382 (Previous Catalog # AAPP04428) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1 |
| Uniprot ID |
Q07352 |
| Protein Name |
Zinc finger protein 36, C3H1 type-like 1 |
| Protein Accession # |
NP_004917 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004926 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZFP36L1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92% |
| Image 1 | Human Placenta
 | WB Suggested Anti-ZFP36L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta |
|
| Image 2 | heart
 | Rabbit Anti-ZFP36L1 Antibody
Catalog Number: ARP33382_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
