| Product Number |
ARP33196_P050 |
| Product Page |
www.avivasysbio.com/grhl3-antibody-c-terminal-region-arp33196-p050.html |
| Name |
GRHL3 Antibody - C-terminal region (ARP33196_P050) |
| Protein Size (# AA) |
509 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
57822 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Grainyhead-like 3 (Drosophila) |
| Description |
|
| Alias Symbols |
SOM, VWS2, TFCP2L4 |
| Peptide Sequence |
Synthetic peptide located within the following region: SGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ting,S.B., et al., (2003) Biochem. J. 370 (PT 3), 953-962 |
| Description of Target |
GRHL3 is a member of the grainyhead family of transcription factors. GRHL3 interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined. |
| Protein Interactions |
PRMT6; PRMT5; PRMT1; GRHL1; GRHL3; GRHL2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GRHL3 (ARP33196_P050) antibody |
| Blocking Peptide |
For anti-GRHL3 (ARP33196_P050) antibody is Catalog # AAP33196 (Previous Catalog # AAPP04233) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GRHL3 |
| Uniprot ID |
Q8TE85-4 |
| Protein Name |
Grainyhead-like protein 3 homolog |
| Publications |
Yu, Z., Mannik, J., Soto, A., Lin, K. K. & Andersen, B. The epidermal differentiation-associated Grainyhead gene Get1/Grhl3 also regulates urothelial differentiation. EMBO J. 28, 1890-903 (2009). 19494835 |
| Protein Accession # |
NP_937817 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_198174 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GRHL3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB, ChIP, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92% |
| Image 1 | Human Placenta
 | WB Suggested Anti-GRHL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Placenta |
|
| Image 2 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: GRHL3
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml |
|
