Product Number |
ARP33196_P050 |
Product Page |
www.avivasysbio.com/grhl3-antibody-c-terminal-region-arp33196-p050.html |
Name |
GRHL3 Antibody - C-terminal region (ARP33196_P050) |
Protein Size (# AA) |
509 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
57822 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Grainyhead-like 3 (Drosophila) |
Description |
|
Alias Symbols |
SOM, VWS2, TFCP2L4 |
Peptide Sequence |
Synthetic peptide located within the following region: SGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ting,S.B., et al., (2003) Biochem. J. 370 (PT 3), 953-962 |
Description of Target |
GRHL3 is a member of the grainyhead family of transcription factors. GRHL3 interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined. |
Protein Interactions |
PRMT6; PRMT5; PRMT1; GRHL1; GRHL3; GRHL2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GRHL3 (ARP33196_P050) antibody |
Blocking Peptide |
For anti-GRHL3 (ARP33196_P050) antibody is Catalog # AAP33196 (Previous Catalog # AAPP04233) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GRHL3 |
Uniprot ID |
Q8TE85-4 |
Protein Name |
Grainyhead-like protein 3 homolog |
Publications |
Yu, Z., Mannik, J., Soto, A., Lin, K. K. & Andersen, B. The epidermal differentiation-associated Grainyhead gene Get1/Grhl3 also regulates urothelial differentiation. EMBO J. 28, 1890-903 (2009). 19494835 |
Protein Accession # |
NP_937817 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_198174 |
Tested Species Reactivity |
Human |
Gene Symbol |
GRHL3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB, ChIP, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92% |
Image 1 | Human Placenta
| WB Suggested Anti-GRHL3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Human Placenta |
|
Image 2 | Human 786-0 Whole Cell
| Host: Rabbit Target Name: GRHL3 Sample Tissue: Human 786-0 Whole Cell Antibody Dilution: 1ug/ml |
|