MYNN Antibody - middle region (ARP33161_T100)

• Product Number: ARP33161_T100
• Name: MYNN Antibody - middle region (ARP33161_T100)
• Protein Size (# AA): 610 amino acids
• Molecular Weight: 69kDa
• NCBI Gene Id: 55892
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Myoneurin
• Alias Symbols: OSZF, SBBIZ1, ZBTB31, ZNF902
• Peptide Sequence: Synthetic peptide located within the following region: CQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Schmid,S.R., et al., (2004) Muscle Nerve 29 (1), 59-65
• Description of Target: Myoneurin belongs to the BTB/POZ and zinc finger protein family whose members have been implicated in regulatory functions of gene expression. Myoneurin has been identified in various tissues, but muscle is a privileged site of myoneurin gene transcription.
• Protein Interactions: CUL3; COPS5; ELAVL1; UBC; PAK1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MYNN (ARP33161_T100) antibody is Catalog # AAP33161 (Previous Catalog # AAPP04194)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYNN
• Uniprot ID: Q86Z12
• Protein Name: Myoneurin
• Protein Accession #: NP_061127
• Purification: Protein A purified
• Nucleotide Accession #: NM_018657
• Tested Species Reactivity: Human
• Gene Symbol: MYNN
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human HepG2
  
  WB Suggested Anti-MYNN Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysate