PLRG1 Antibody - N-terminal region (ARP33046_P050)

Data Sheet
 
Product Number ARP33046_P050
Product Page www.avivasysbio.com/plrg1-antibody-n-terminal-region-arp33046-p050.html
Name PLRG1 Antibody - N-terminal region (ARP33046_P050)
Protein Size (# AA) 514 amino acids
Molecular Weight 57kDa
NCBI Gene Id 5356
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Pleiotropic regulator 1
Alias Symbols Cwc1, PRL1, PRP46, PRPF46, TANGO4
Peptide Sequence Synthetic peptide located within the following region: YGPVLHMPTSKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ajuh,P., et al., (2003) Nucleic Acids Res. 31 (21), 6104-6116
Description of Target PLRG1 is necessary for spliceosome assembly and for pre-mRNA splicing.
Protein Interactions UBC; SUMO1; NEDD8; SUZ12; BMI1; rev; CSNK2A2; SF3B1; WHSC1; EIF4A3; MAGOH; MDC1; ZCRB1; USB1; ISY1; XAB2; UCHL5; RBM14; SF3A1; BCAS2; RBM39; PRPF4; SNRPA1; RPL9; CDC5L; APP; CWC15; PRPF19; U2AF2; CUL3; SF3A2; Prpf8; Snw1; TADA2A; CTNNBL1; KPNA2; KPNA1; SR
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PLRG1 (ARP33046_P050) antibody
Blocking Peptide For anti-PLRG1 (ARP33046_P050) antibody is Catalog # AAP33046 (Previous Catalog # AAPP04075)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PLRG1
Uniprot ID O43660
Protein Name Pleiotropic regulator 1
Protein Accession # NP_002660
Purification Affinity Purified
Nucleotide Accession # NM_002669
Tested Species Reactivity Human
Gene Symbol PLRG1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 83%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%
Image 1
Human Small Intestine
WB Suggested Anti-PLRG1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com