PSMD11 Antibody - C-terminal region (ARP33002_T100)

• Product Number: ARP33002_T100
• Name: PSMD11 Antibody - C-terminal region (ARP33002_T100)
• Protein Size (# AA): 422 amino acids
• Molecular Weight: 47 kDa
• Subunit: 11
• NCBI Gene Id: 5717
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
• Alias Symbols: S9, Rpn6, p44.5
• Peptide Sequence: Synthetic peptide located within the following region: ALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Conticello,S.G., et al., (2003) Biol. 13 (22), 2009-2013
• Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator.
• Protein Interactions: HUWE1; SUMO2; SUMO3; PSMD14; UBC; MDM2; ASB11; SHFM1; PSMC2; PSMC1; RPS8; PSMD12; PSMD8; PSMD3; PSMD1; PSMC6; PSMC5; KCMF1; PRMT6; UCHL5; KIAA0368; ADRM1; RPS21; RPS15A; PARK2; RNF11; NOS2; SMAD5; SMAD4; SMAD3; SMAD2; SMAD1; FN1; CFTR; VCAM1; LRRK2; env;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-PSMD11 (ARP33002_T100) antibody is Catalog # AAP33002 (Previous Catalog # AAPP04031)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSMD11
• Uniprot ID: O00231
• Protein Name: 26S proteasome non-ATPase regulatory subunit 11
• Protein Accession #: NP_002806
• Purification: Protein A purified
• Nucleotide Accession #: NM_002815
• Tested Species Reactivity: Human
• Gene Symbol: PSMD11
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
• Image 1: Human kidney
  
  Human kidney
• Image 2: MCF7, THP-1
  
  Host: Rabbit
  Target: PSMD11
  Positive control (+): MCF7 (N10)
  Negative control (-): THP-1 (N30)
  Antibody concentration: 5ug/ml