ZNF537 Antibody - middle region (ARP32963_P050)

Data Sheet
 
Product Number ARP32963_P050
Product Page www.avivasysbio.com/znf537-antibody-middle-region-arp32963-p050.html
Name ZNF537 Antibody - middle region (ARP32963_P050)
Protein Size (# AA) 898 amino acids
Molecular Weight 98kDa
NCBI Gene Id 57616
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Teashirt zinc finger homeobox 3
Alias Symbols TSH3, ZNF537
Peptide Sequence Synthetic peptide located within the following region: LNVEVKKEVDKEKAVTDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEES
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nagase,T., et al., (2000) DNA Res. 7 (2), 143-150
Description of Target The ZNF537 gene is located on chromosome 19.
Protein Interactions CCDC155; KRT40; CEP70; CEP63; TRIM54; TFIP11; MTUS2; SPAG5; TAX1BP1; MAD1L1; TRAF2; TRIM27; CTBP2; CTBP1; TRIM23; SOX2; UBC; APBB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TSHZ3 (ARP32963_P050) antibody
Blocking Peptide For anti-TSHZ3 (ARP32963_P050) antibody is Catalog # AAP32963 (Previous Catalog # AAPP03987)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF537
Uniprot ID Q9H0G6
Protein Name Teashirt homolog 3
Protein Accession # NP_065907
Purification Affinity Purified
Nucleotide Accession # NM_020856
Tested Species Reactivity Human
Gene Symbol TSHZ3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 85%; Rat: 86%
Image 1
Human Lung
WB Suggested Anti-ZNF537 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com