| Product Number |
ARP32802_P050 |
| Product Page |
www.avivasysbio.com/aqp7-antibody-c-terminal-region-arp32802-p050.html |
| Name |
AQP7 Antibody - C-terminal region (ARP32802_P050) |
| Protein Size (# AA) |
342 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
364 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Aquaporin 7 |
| Alias Symbols |
AQP7L, AQPap, GLYCQTL |
| Peptide Sequence |
Synthetic peptide located within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kondo,H., et al., (2002) Eur. J. Biochem. 269 (7), 1814-1826 |
| Description of Target |
Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AQP7 (ARP32802_P050) antibody |
| Blocking Peptide |
For anti-AQP7 (ARP32802_P050) antibody is Catalog # AAP32802 (Previous Catalog # AAPP03821) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human AQP7 |
| Uniprot ID |
O14520 |
| Protein Name |
Aquaporin-7 |
| Protein Accession # |
NP_001161 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001170 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AQP7 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Heart
 | WB Suggested Anti-AQP7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart |
|
|
