website statistics
Product Datasheet: ARP32802_P050 - AQP7 antibody - C-terminal region (ARP32802_P050) - Aviva Systems Biology
AQP7 antibody - C-terminal region (ARP32802_P050)
Data Sheet
Product Number ARP32802_P050
Product Page
Product Name AQP7 antibody - C-terminal region (ARP32802_P050)
Size 100 ul
Gene Symbol AQP7
Alias Symbols AQP9, AQP7L, AQPap, GLYCQTL
Protein Size (# AA) 342 amino acids
Molecular Weight 37kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 364
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Aquaporin 7
Description This is a rabbit polyclonal antibody against AQP7. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA
Target Reference Kondo,H., et al., (2002) Eur. J. Biochem. 269 (7), 1814-1826
Description of Target Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-AQP7 (ARP32802_P050) antibody is Catalog # AAP32802 (Previous Catalog # AAPP03821)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human AQP7
Complete computational species homology data Anti-AQP7 (ARP32802_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express AQP7.
Swissprot Id O14520
Protein Name Aquaporin-7
Protein Accession # NP_001161
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express AQP7.
Nucleotide Accession # NM_001170
Replacement Item This antibody may replace item sc-14972 from Santa Cruz Biotechnology.
Conjugation Options

ARP32802_P050-FITC Conjugated

ARP32802_P050-HRP Conjugated

ARP32802_P050-Biotin Conjugated

CB Replacement sc-14972; sc-14974; sc-14980; sc-28625
Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Heart
WB Suggested Anti-AQP7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |