| Product Number |
ARP32774_T100 |
| Product Page |
www.avivasysbio.com/htatip2-antibody-n-terminal-region-arp32774-t100.html |
| Name |
HTATIP2 Antibody - N-terminal region (ARP32774_T100) |
| Protein Size (# AA) |
242 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
10553 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
HIV-1 Tat interactive protein 2, 30kDa |
| Alias Symbols |
CC3, TIP30, SDR44U1 |
| Peptide Sequence |
Synthetic peptide located within the following region: TGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Jiang,C.,et al.,(2004) J.Biol.Chem.279(26),27781-27789 |
| Description of Target |
CC3 (HTATIP2) is a member of the short-chain dehydrogenases/reductases (SDR) family. It is a novel serine/threonine kinase that phosphorylates the C-terminal domain (CTD) of the largest RNA polymerase II subunit and induces the expression of apoptosis related genes Bad and Siva, as well as metastasis suppressor NM23-H2. It also interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates ERalpha-mediated c-myc transcription. |
| Protein Interactions |
UBC; NCOA5; ASF1A; ETS1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HTATIP2 (ARP32774_T100) antibody |
| Blocking Peptide |
For anti-HTATIP2 (ARP32774_T100) antibody is Catalog # AAP32774 (Previous Catalog # AAPP03789) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HTATIP2 |
| Uniprot ID |
O15383 |
| Protein Name |
Oxidoreductase HTATIP2 |
| Protein Accession # |
NP_006401 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_006410 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HTATIP2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Lung
 | Human Lung |
| | Image 2 | Human Liver
 | Human Liver |
| | Image 3 | Human Jurkat
 | WB Suggested Anti-HTATIP2 Antibody Titration: 0.5-1.0ug/ml
Positive Control: Jurkat cell lysate |
|
|
