CITED1 Antibody - middle region (ARP32705_P050)

• Product Number: ARP32705_P050
• Name: CITED1 Antibody - middle region (ARP32705_P050)
• Protein Size (# AA): 219 amino acids
• Molecular Weight: 23 kDa
• NCBI Gene Id: 4435
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
• Alias Symbols: MSG1
• Peptide Sequence: Synthetic peptide located within the following region: IGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fenner,M.H.,et al.,(1998) Genomics 51(3),401-407
• Description of Target: CBP/p300-interacting transactivator 1 (CITED1, melanocyte-specific protein 1 ) is a nuclear protein that shares two highly conserved domains, CR1 and CR2. The CR2 domain is significantly acidic and activates transcription in yeast cells.
• Protein Interactions: LNX1; ESR1; HSPA8; EP300; TFAP2C; SMAD4; CREBBP; TFAP2B;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CITED1 (ARP32705_P050) antibody is Catalog # AAP32705 (Previous Catalog # AAPP03719)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CITED1
• Uniprot ID: Q99966
• Protein Name: Cbp/p300-interacting transactivator 1
• Protein Accession #: NP_004134
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004143
• Tested Species Reactivity: Human
• Gene Symbol: CITED1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 85%; Guinea Pig: 85%; Human: 100%; Mouse: 77%; Rabbit: 83%; Rat: 85%
• Image 1: Human Lung
  
  Human Lung
• Image 2: Human kidney
  
  Human kidney
• Image 3: Human MKN45 Whole Cell
  
  Host: Rabbit
  Target Name: CITED1
  Sample Tissue: Human MKN45 Whole Cell
  Antibody Dilution: 5ug/ml
• Image 4: Human Fetal Liver
  
  Host: Rabbit
  Target Name: CITED1
  Sample Tissue: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 5:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.