| Product Number |
ARP32667_P050 |
| Product Page |
www.avivasysbio.com/insm1-antibody-c-terminal-region-arp32667-p050.html |
| Name |
INSM1 Antibody - C-terminal region (ARP32667_P050) |
| Protein Size (# AA) |
510 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
3642 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Insulinoma-associated 1 |
| Alias Symbols |
IA1, IA-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LQAKGAPLAPPAEDLLALYPGPDEKAPQEAAGDGEGAGVLGLSASAECHL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Breslin,M.B., et al., (2003) J. Biol. Chem. 278 (40), 38991-38997 |
| Description of Target |
The insulinoma-associated 1 (INSM1) gene is intronless and encodes a protein containing both a zinc finger DNA-binding domain and a putative prohormone domain. This gene is a sensitive marker for neuroendocrine differentiation of human lung tumors. |
| Protein Interactions |
HDAC3; HDAC1; CCND1; SORBS1; TUBB3; MPP3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-INSM1 (ARP32667_P050) antibody |
| Blocking Peptide |
For anti-INSM1 (ARP32667_P050) antibody is Catalog # AAP32667 (Previous Catalog # AAPP03677) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human INSM1 |
| Uniprot ID |
Q01101 |
| Protein Name |
Insulinoma-associated protein 1 |
| Protein Accession # |
NP_002187 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002196 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
INSM1 |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 92%; Horse: 85%; Human: 100%; Pig: 92% |
| Image 1 | Human Lung
 | WB Suggested Anti-INSM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung |
|
|
