TAF5L Antibody - N-terminal region (ARP32566_T100)

• Product Number: ARP32566_T100
• Name: TAF5L Antibody - N-terminal region (ARP32566_T100)
• Protein Size (# AA): 589 amino acids
• Molecular Weight: 66kDa
• Subunit: 5L
• NCBI Gene Id: 27097
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
• Alias Symbols: PAF65B
• Peptide Sequence: Synthetic peptide located within the following region: LTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ogryzko,V.V., et al., (1998) Cell 94 (1), 35-44
• Description of Target: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF5L encodes a protein that is a component of the PCAF histone acetylase complex and structurally similar to one of the histone-like TAFs, TAF5. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation.
• Protein Interactions: HECW2; UBC; KAT2B; LSM11; TADA3; TAF10; ELAVL1; TSC22D1; TTR; H2AFX; CDKN1A; ANXA7; KAT2A; TP53; ATXN7; CEBPE; USP22; ATXN7L3; SUPT3H; TAF9; MYC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TAF5L (ARP32566_T100) antibody is Catalog # AAP32566 (Previous Catalog # AAPP03569)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAF5L
• Uniprot ID: O75529
• Protein Name: TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
• Sample Type Confirmation:

  TAF5L is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_055224
• Purification: Protein A purified
• Nucleotide Accession #: NM_014409
• Tested Species Reactivity: Human
• Gene Symbol: TAF5L
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-TAF5L Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysateTAF5L is supported by BioGPS gene expression data to be expressed in Jurkat
• Image 2: Human Lung
  
  Rabbit Anti-TAF5L Antibody
  Catalog Number: ARP32566
  Paraffin Embedded Tissue: Human alveolar cell
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X