POU2F3 Antibody - N-terminal region (ARP32537_T100)

• Product Number: ARP32537_T100
• Name: POU2F3 Antibody - N-terminal region (ARP32537_T100)
• Protein Size (# AA): 436 amino acids
• Molecular Weight: 47kDa
• NCBI Gene Id: 25833
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: POU class 2 homeobox 3
• Alias Symbols: PLA1, OCT11, PLA-1, Epoc-1, OCT-11, OTF-11, Skn-1a
• Peptide Sequence: Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Enomoto,Y., et al., (2004) Oncogene 23 (29), 5014-5022
• Description of Target: POU domain genes encode a family of highly conserved transacting factors that influence the transcriptional activity of several cell type-specific and ubiquitous genes. Studies have cloned and sequenced cDNAs encoding a novel mouse POU domain protein, Oct-11, that is closely related within the POU domain to the POU class II proteins, Oct-1 and Oct-2.
• Protein Interactions: UBC; BCL6; CREBBP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-POU2F3 (ARP32537_T100) antibody is Catalog # AAP32537
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
• Uniprot ID: Q9UKI9
• Protein Name: POU domain, class 2, transcription factor 3
• Protein Accession #: NP_055167
• Purification: Protein A purified
• Nucleotide Accession #: NM_014352
• Tested Species Reactivity: Human, Mouse, Rat
• Gene Symbol: POU2F3
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
• Image 1: Human HepG2
  
  WB Suggested Anti-POU2F3 Antibody
  Titration: 1.25 ug/ml
  Positive Control: HepG2 Whole Cell
• Image 2: Mouse tongue
  
  Sample Type:
  Mouse tongue tissue
  Primary Antibody Dilution:
  1:100
  Secondary Antibody:
  Anti-rabbit-Cy3
  Secondary Antibody Dilution:
  1:500
  Color/Signal Descriptions:
  Red: POU2F3
  Gene Name:
  POU2F3
  Submitted by:
  Dr. Hong Wang, Monell Chemical Senses Center
• Image 3: Rat Brain
  
  Host: Rat
  Target Name: POU2F3
  Sample Tissue: Rat Brain
  Antibody Dilution: 1ug/ml