ZC3H7B Antibody - N-terminal region (ARP32500_T100)

• Product Number: ARP32500_T100
• Name: ZC3H7B Antibody - N-terminal region (ARP32500_T100)
• Protein Size (# AA): 977 amino acids
• Molecular Weight: 110kDa
• NCBI Gene Id: 23264
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger CCCH-type containing 7B
• Alias Symbols: RoXaN, ROXAN1
• Peptide Sequence: Synthetic peptide located within the following region: YECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETFSLLSN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Vitour,D., et al., (2004) J. Virol. 78 (8), 3851-3862
• Description of Target: ZC3H7B is a protein that contains a tetratricopeptide repeat domain. The encoded protein also interacts with the rotavirus non-structural protein NSP3.
• Protein Interactions: UBC; HECW2; HSP90AA1; RC3H1; UBXN6; ZYX; ATXN1L; ATXN1; EIF4G1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZC3H7B (ARP32500_T100) antibody is Catalog # AAP32500 (Previous Catalog # AAPP03503)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZC3H7B
• Uniprot ID: Q9UGR2-2
• Protein Name: Zinc finger CCCH domain-containing protein 7B
• Protein Accession #: NP_060060
• Purification: Protein A purified
• Nucleotide Accession #: NM_017590
• Tested Species Reactivity: Human
• Gene Symbol: ZC3H7B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
• Image 1: Human Liver
  
  WB Suggested Anti-ZC3H7B Antibody Titration: 4ug/ml
  Positive Control: Human Liver