| Product Number |
ARP32443_P050 |
| Product Page |
www.avivasysbio.com/lhx3-antibody-middle-region-arp32443-p050.html |
| Name |
LHX3 Antibody - middle region (ARP32443_P050) |
| Protein Size (# AA) |
397 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
8022 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
LIM homeobox 3 |
| Alias Symbols |
LIM3, CPHD3, M2-LHX3 |
| Peptide Sequence |
Synthetic peptide located within the following region: NMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yaden,B.C., et al., (2006) Endocrinology 147 (1), 324-337 |
| Description of Target |
LHX3 is a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene. |
| Protein Interactions |
ISL2; IFT172; LDB1; CITED2; ISL1; RLIM; LMX1A; LHX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LHX3 (ARP32443_P050) antibody |
| Blocking Peptide |
For anti-LHX3 (ARP32443_P050) antibody is Catalog # AAP32443 (Previous Catalog # AAPP03439) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LHX3 |
| Uniprot ID |
Q9UBR4 |
| Protein Name |
LIM/homeobox protein Lhx3 |
| Protein Accession # |
NP_835258 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_178138 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LHX3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 87%; Horse: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 93%; Zebrafish: 92% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-LHX3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
