Product Number |
ARP32430_P050 |
Product Page |
www.avivasysbio.com/bhlhb5-antibody-n-terminal-region-arp32430-p050.html |
Name |
BHLHB5 Antibody - N-terminal region (ARP32430_P050) |
Protein Size (# AA) |
381 amino acids |
Molecular Weight |
37kDa |
NCBI Gene Id |
27319 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Basic helix-loop-helix family, member e22 |
Alias Symbols |
Beta3, BHLHB5, Beta3a, CAGL85, TNRC20 |
Peptide Sequence |
Synthetic peptide located within the following region: LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
McLellan,A.S., et al., (2002) Mech. Dev. 119 SUPPL 1, S285-S291 |
Description of Target |
BHLHB5 is a member of family of basic helix-loop-helix (bHLH) transcription factors. Members of this family have been implicated in many aspects of neural development, including cell growth, differentiation, and cell migration. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-BHLHE22 (ARP32430_P050) antibody |
Blocking Peptide |
For anti-BHLHE22 (ARP32430_P050) antibody is Catalog # AAP32430 (Previous Catalog # AAPP03426) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BHLHB5 |
Uniprot ID |
Q8NFJ8 |
Protein Name |
Class E basic helix-loop-helix protein 22 |
Protein Accession # |
NP_689627 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152414 |
Tested Species Reactivity |
Human |
Gene Symbol |
BHLHE22 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-BHLHB5 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|