SIRT7 Antibody - C-terminal region (ARP32406_P050)

Data Sheet
 
Product Number ARP32406_P050
Product Page www.avivasysbio.com/sirt7-antibody-c-terminal-region-arp32406-p050.html
Name SIRT7 Antibody - C-terminal region (ARP32406_P050)
Protein Size (# AA) 400 amino acids
Molecular Weight 45kDa
NCBI Gene Id 51547
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sirtuin 7
Alias Symbols SIR2L7
Peptide Sequence Synthetic peptide located within the following region: DVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mahon,P.C., et al., (2000) Biochem. Biophys. Res. Commun. 273 (2), 793-798
Description of Target SIRT7 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT7 is included in class IV of the sirtuin family.
Protein Interactions DDB1; VPRBP; APP; NOL6; YTHDC2; DDX31; RBM15; ANAPC1; NSD1; NOC3L; UBE2O; RBM25; CCAR2; CHD8; BEND3; PHRF1; DHX37; NUFIP2; CGN; XPO5; LRRC47; BIRC6; WDR18; THOC2; NUP107; REXO4; DDX24; XAB2; UGGT1; ZC3HAV1; YLPM1; NKRF; CCT5; SNW1; DHX30; DIS3; PUF60; COP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SIRT7 (ARP32406_P050) antibody
Blocking Peptide For anti-SIRT7 (ARP32406_P050) antibody is Catalog # AAP32406 (Previous Catalog # AAPP03401)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SIRT7
Uniprot ID Q9NRC8
Protein Name NAD-dependent protein deacetylase sirtuin-7
Protein Accession # NP_057622
Purification Affinity Purified
Nucleotide Accession # NM_016538
Tested Species Reactivity Human
Gene Symbol SIRT7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-SIRT7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com