| Product Number |
ARP32390_P050 |
| Product Page |
www.avivasysbio.com/sirt5-antibody-c-terminal-region-arp32390-p050.html |
| Name |
SIRT5 Antibody - C-terminal region (ARP32390_P050) |
| Protein Size (# AA) |
299 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
23408 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sirtuin 5 |
| Alias Symbols |
SIR2L5 |
| Peptide Sequence |
Synthetic peptide located within the following region: EVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Frye, R.A. (2000) Biochem. Biophys. Res. Commun. 273 (2), 793-798 |
| Description of Target |
SIRT5 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants. |
| Protein Interactions |
SIRT3; UBC; HECW2; APP; RELA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SIRT5 (ARP32390_P050) antibody |
| Blocking Peptide |
For anti-SIRT5 (ARP32390_P050) antibody is Catalog # AAP32390 (Previous Catalog # AAPP03380) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SIRT5 |
| Uniprot ID |
Q9NXA8 |
| Protein Name |
NAD-dependent protein deacylase sirtuin-5, mitochondrial |
| Protein Accession # |
NP_112534 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_031244 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SIRT5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%; Zebrafish: 100% |
| Image 1 | Human Spermatophore
 | Human Spermatophore |
|
| Image 2 | Human Intestine
 | Human Intestine |
|
| Image 3 | Human HepG2
 | WB Suggested Anti-SIRT5 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
