Product Number |
ARP32363_T100 |
Product Page |
www.avivasysbio.com/tbx19-antibody-n-terminal-region-arp32363-t100.html |
Name |
TBX19 Antibody - N-terminal region (ARP32363_T100) |
Protein Size (# AA) |
448 amino acids |
Molecular Weight |
48kDa |
NCBI Gene Id |
9095 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
T-box 19 |
Alias Symbols |
TPIT, TBS19, dJ747L4.1 |
Peptide Sequence |
Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Maira,M.,et al.,(2003) J.Biol.Chem.278(47),46523-46532 |
Description of Target |
TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. |
Protein Interactions |
NR5A1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TBX19 (ARP32363_T100) antibody |
Blocking Peptide |
For anti-TBX19 (ARP32363_T100) antibody is Catalog # AAP32363 (Previous Catalog # AAPP03352) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TBX19 |
Uniprot ID |
O60806 |
Protein Name |
T-box transcription factor TBX19 |
Protein Accession # |
NP_005140 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_005149 |
Tested Species Reactivity |
Human |
Gene Symbol |
TBX19 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-TBX19 Antibody Titration: 1.0-1.5ug/ml Positive Control: Jurkat cell lysate |
| Image 2 | Human Liver
| Human Liver |
| Image 3 | Human kidney
| Human kidney |
|
|