Product Number |
ARP32324_P050 |
Product Page |
www.avivasysbio.com/ldb2-antibody-middle-region-arp32324-p050.html |
Name |
LDB2 Antibody - middle region (ARP32324_P050) |
Protein Size (# AA) |
373 amino acids |
Molecular Weight |
43kDa |
NCBI Gene Id |
9079 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
LIM domain binding 2 |
Alias Symbols |
LDB1, CLIM1, LDB-2 |
Peptide Sequence |
Synthetic peptide located within the following region: LENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQAS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Colland,F., (2004) Genome Res. 14 (7), 1324-1332 |
Description of Target |
LDB2 belongs to the LDB family. LDB2 binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LIM domains are required for both inhibitory effects on LIM homeodomain transcription factors and synergistic transcriptional activation events. The inhibitory actions of the LIM domain can often be overcome by the LIM co-regulators known as CLIM2, LDB2 and NLI. LIM homeoproteins and CLIMs are involved in a variety of developmental processes. |
Protein Interactions |
LHX4; RILP; LMO3; RASIP1; SSBP3; SSBP2; LMO4; TSNAX; UBC; SSBP4; ISL1; LHX9; RLIM; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LDB2 (ARP32324_P050) antibody |
Blocking Peptide |
For anti-LDB2 (ARP32324_P050) antibody is Catalog # AAP32324 (Previous Catalog # AAPP03311) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LDB2 |
Uniprot ID |
O43679 |
Protein Name |
LIM domain-binding protein 2 |
Protein Accession # |
NP_001281 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001290 |
Tested Species Reactivity |
Human |
Gene Symbol |
LDB2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 83%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Small Intestine
| WB Suggested Anti-LDB2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Small Intestine |
|
|