| Product Number |
ARP32309_P050 |
| Product Page |
www.avivasysbio.com/hdac6-antibody-n-terminal-region-arp32309-p050.html |
| Name |
Hdac6 Antibody - N-terminal region (ARP32309_P050) |
| Protein Size (# AA) |
1152 amino acids |
| Molecular Weight |
125kDa |
| NCBI Gene Id |
84581 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Histone deacetylase 6 |
| Alias Symbols |
Hdac6 |
| Peptide Sequence |
Synthetic peptide located within the following region: RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Hdac6 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Hdac6 (ARP32309_P050) antibody |
| Additional Information |
IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml. |
| Blocking Peptide |
For anti-Hdac6 (ARP32309_P050) antibody is Catalog # AAP32309 (Previous Catalog # AAPP03292) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
Q9UBN7 |
| Protein Accession # |
XP_228753 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_228753 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Hdac6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 86% |
| Image 1 | heart
 | Rabbit Anti-Hdac6 Antibody
Catalog Number: ARP32309_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
| Image 2 | Mouse Liver
 | WB Suggested Anti-Hdac6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Liver |
|
| Image 3 | Human Testis
 | Testis |
|
| Image 4 | Mouse Testis
 | Host: Rabbit
Target Name: HDAC6
Sample Tissue: Mouse Testis
Antibody Dilution: 3ug/ml |
|
| Image 5 | Mouse Testis
 | Host: Rabbit
Target Name: HDAC6
Sample Tissue: Mouse Testis
Antibody Dilution: 3ug/ml |
|
| Image 6 | Mouse Testis
 | Host: Rabbit
Target Name: HDAC6
Sample Tissue: Mouse Testis
Antibody Dilution: 3ug/ml |
|
