| Product Number |
ARP32282_P050 |
| Product Page |
www.avivasysbio.com/znf409-antibody-middle-region-arp32282-p050.html |
| Name |
ZNF409 Antibody - middle region (ARP32282_P050) |
| Protein Size (# AA) |
862 amino acids |
| Molecular Weight |
92kDa |
| NCBI Gene Id |
22830 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 409 |
| Peptide Sequence |
Synthetic peptide located within the following region: GGQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZNF209 is a candidate transcription factor |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF409 (ARP32282_P050) antibody |
| Blocking Peptide |
For anti-ZNF409 (ARP32282_P050) antibody is Catalog # AAP32282 (Previous Catalog # AAPP03264) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF409 |
| Uniprot ID |
Q9UPU6 |
| Protein Name |
Zinc finger homeobox protein 2 |
| Protein Accession # |
XP_375065 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_375065 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF409 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 87%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF409 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
