| Product Number |
ARP32135_P050 |
| Product Page |
www.avivasysbio.com/myf6-antibody-n-terminal-region-arp32135-p050.html |
| Name |
MYF6 Antibody - N-terminal region (ARP32135_P050) |
| Protein Size (# AA) |
242 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
4618 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Myogenic factor 6 (herculin) |
| Alias Symbols |
CNM3, MRF4, myf-6, bHLHc4 |
| Peptide Sequence |
Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Roy,K., et al., (2002) J. Biol. Chem. 277 (37), 33818-33824 |
| Description of Target |
MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program. |
| Protein Interactions |
ID1; CSRP3; ID2; ID3; CALM3; CALM1; ELSPBP1; TCF3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MYF6 (ARP32135_P050) antibody |
| Blocking Peptide |
For anti-MYF6 (ARP32135_P050) antibody is Catalog # AAP32135 (Previous Catalog # AAPP03087) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MYF6 |
| Uniprot ID |
P23409 |
| Protein Name |
Myogenic factor 6 |
| Protein Accession # |
NP_002460 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002469 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MYF6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
| Image 1 | Human Pancreas
 | Human Pancreas |
|
| Image 2 | Human Intestine
 | Human Intestine |
|
| Image 3 | Human heart
 | WB Suggested Anti-MYF6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human heart |
|
