MYF6 antibody - N-terminal region (ARP32135_P050)
Data Sheet
Product Number ARP32135_P050
Product Page
Product Name MYF6 antibody - N-terminal region (ARP32135_P050)
Size 100 ul
Gene Symbol MYF6
Alias Symbols MRF4, CNM3, myf-6, bHLHc4
Protein Size (# AA) 242 amino acids
Molecular Weight 27kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 4618
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Myogenic factor 6 (herculin)
Description This is a rabbit polyclonal antibody against MYF6. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA
Target Reference Roy,K., et al., (2002) J. Biol. Chem. 277 (37), 33818-33824
Description of Target MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.
Protein Interactions ID1; CSRP3; ID2; ID3; CALM3; CALM1; ELSPBP1; TCF3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-MYF6 (ARP32135_P050) antibody is Catalog # AAP32135 (Previous Catalog # AAPP03087)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MYF6
Complete computational species homology data Anti-MYF6 (ARP32135_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MYF6.
Swissprot Id P23409
Protein Name Myogenic factor 6
Protein Accession # NP_002460
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MYF6.
Nucleotide Accession # NM_002469
Replacement Item This antibody may replace item sc-176122 from Santa Cruz Biotechnology.
Conjugation Options

ARP32135_P050-FITC Conjugated

ARP32135_P050-HRP Conjugated

ARP32135_P050-Biotin Conjugated

CB Replacement sc-176122; sc-301; sc-31950; sc-31951; sc-31952; sc-514379; sc-784
Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Image 1
Human Pancreas
Human Pancreas
Image 2
Human Intestine
Human Intestine
Image 3
Human heart
WB Suggested Anti-MYF6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human heart

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |