| Product Number |
ARP32121_P050 |
| Product Page |
www.avivasysbio.com/pik3r1-antibody-c-terminal-region-arp32121-p050.html |
| Name |
Pik3r1 Antibody - C-terminal region (ARP32121_P050) |
| Protein Size (# AA) |
454 amino acids |
| Molecular Weight |
53kDa |
| Subunit |
alpha |
| NCBI Gene Id |
18708 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha) |
| Alias Symbols |
PI, p50, p55, p85, PI3K, p50alpha, p55alpha, p85alpha |
| Peptide Sequence |
Synthetic peptide located within the following region: HEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Ubc; Pa2g4; Pik3ca; Jup; Hras; Akt1; Dok1; Crkl; Cbl; Irs1; Epor; Csf1r; Cdh2; Cdh1; Thrb; Ncor1; Psen1; Kit; Gab1; Irs2; Ep300; Crk; Fyn; Fos; Lck; Erbb2; SH3KBP1; Cd40; Tnfrsf11a; Grin2b; Grin1; Grb10; Jak2; Tek; Cd19; Grb2; Axl; Enkur; Ptk2; Stat3; Sh3 |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Pik3r1 (ARP32121_P050) antibody |
| Blocking Peptide |
For anti-Pik3r1 (ARP32121_P050) antibody is Catalog # AAP32121 (Previous Catalog # AAPP03204) |
| Uniprot ID |
Q80UI5 |
| Protein Name |
Phosphatidylinositol 3-kinase regulatory subunit alpha Ensembl ENSMUSP00000047004 |
| Protein Accession # |
NP_001020126 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001024955 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Pik3r1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-Pik3r1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain |
|
|
