| Product Number |
ARP32036_T100 |
| Product Page |
http://www.avivasysbio.com/anti-neurod1-antibody-n-terminal-region-arp32036-t100.html |
| Product Name |
NEUROD1 antibody - N-terminal region (ARP32036_T100) |
| Size |
100ug |
| Gene Symbol |
NEUROD1 |
| Alias Symbols |
BETA2; BHF-1; MODY6; NEUROD; bHLHa3 |
| Nucleotide Accession# |
NM_002500 |
| Protein Accession# |
NP_002491 |
| Swissprot Id |
Q13562 |
| Protein Size (# AA) |
356 amino acids |
| Molecular Weight |
40kDa |
| Product Format |
Lyophilized powder |
| NCBI Gene Id |
4760 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Purification |
Protein A purified |
| Official Gene Full Name |
Neuronal differentiation 1 |
| Description |
This is a rabbit polyclonal antibody against NEUROD1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEE |
| Key Reference |
Peng,S.Y., et al., (2005) Biochim. Biophys. Acta 1731 (3), 154-159 |
| Description of Target |
NeuroD1is a members of bHLH family that involves in neuroendocrine differentiation. |
| Partner Proteins |
PKN1, PKN1 |
| Reconstitution and Storage |
Add 100 μl of distilled water. Final anti-NEUROD1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-NEUROD1 antibody is Catalog # AAP32036 (Previous Catalog # AAPP02938) |
| Immunogen |
The immunogen for anti-NEUROD1 antibody: synthetic peptide directed towards the N terminal of human NEUROD1 |
| Complete computational species homology data |
NEUROD1 antibody - N-terminal region (ARP32036_T100) |
| Tissue Tool |
Find tissues and cell lines supported to express NEUROD1.  |
| Reviews and Data |
Computational species homology for NEUROD1 antibody (ARP32036); Product Protocols: NEUROD1 antibody tested with Human Jurkat Cells (ARP32036_T100) |
| Homology Short |
Horse, Human, Mouse, Rat, Bovine, Dog, Pig |
| Observed Species Reactivity |
Human, Mouse, Rat, Bovine, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Dog: 92%; Pig: 92% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-NEUROD1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
