NEUROD1 Antibody - N-terminal region (ARP32036_T100)

Data Sheet
 
Product Number ARP32036_T100
Product Page www.avivasysbio.com/neurod1-antibody-n-terminal-region-arp32036-t100.html
Name NEUROD1 Antibody - N-terminal region (ARP32036_T100)
Protein Size (# AA) 356 amino acids
Molecular Weight 40kDa
NCBI Gene Id 4760
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Neuronal differentiation 1
Description
Alias Symbols T2D, BETA2, BHF-1, MODY6, NEUROD, bHLHa3
Peptide Sequence Synthetic peptide located within the following region: MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Peng,S.Y., et al., (2005) Biochim. Biophys. Acta 1731 (3), 154-159
Description of Target NeuroD1is a members of bHLH family that involves in neuroendocrine differentiation.
Protein Interactions DUSP3; SMARCA4; MAFA; EP300; TCF4; RREB1; PITX1; NEUROD1; HAP1; PDX1; CALM3; CALM1; CCND1; MAP3K10; HTT;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NEUROD1 (ARP32036_T100) antibody
Blocking Peptide For anti-NEUROD1 (ARP32036_T100) antibody is Catalog # AAP32036 (Previous Catalog # AAPP02938)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NEUROD1
Uniprot ID Q13562
Protein Name Neurogenic differentiation factor 1
Publications

Genome-wide characterization of menin-dependent H3K4me3 reveals a specific role for menin in the regulation of genes implicated in MEN1-like tumors. PLoS One. 7, e37952 (2012). 22666422

Protein Accession # NP_002491
Purification Protein A purified
Nucleotide Accession # NM_002500
Tested Species Reactivity Human
Gene Symbol NEUROD1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-NEUROD1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com