HOXC4 Antibody - N-terminal region (ARP31957_T100)

• Product Number: ARP31957_T100
• Name: HOXC4 Antibody - N-terminal region (ARP31957_T100)
• Protein Size (# AA): 264 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 3221
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Homeobox C4
• Alias Symbols: HOX3, cp19, HOX3E
• Peptide Sequence: Synthetic peptide located within the following region: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Schaffer,A., et al., (2003) J. Biol. Chem. 278 (25), 23141-23150
• Description of Target: HOXC4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, are co-transcribed in a primary transcript. Subsequent processing results in gene-specific transcripts, which sometimes share a 5' non-coding exon.
• Protein Interactions: NCK2; PRMT6; WHSC1L1; PRMT5; SUV39H1; LYN; ELMOD2; RNF32; HTT; XRCC5; POU2F1; XRCC6; SOX10; PRKDC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HOXC4 (ARP31957_T100) antibody is Catalog # AAP31957 (Previous Catalog # AAPP02854)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC4
• Uniprot ID: P09017
• Protein Name: Homeobox protein Hox-C4
• Protein Accession #: NP_705897
• Purification: Protein A purified
• Nucleotide Accession #: NM_153633
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: HOXC4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Liver
  
  WB Suggested Anti-HOXC4 Antibody Titration: 2.0ug/ml
  Positive Control: Human Liver
• Image 2: Mouse Liver
  
  Host: Mouse
  Target Name: HOXC4
  Sample Tissue: Mouse Liver
  Antibody Dilution: 1ug/ml