| Product Number |
ARP31586_T100 |
| Product Page |
www.avivasysbio.com/zfp1-antibody-n-terminal-region-arp31586-t100.html |
| Name |
ZFP1 Antibody - N-terminal region (ARP31586_T100) |
| Protein Size (# AA) |
352 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
162239 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 1 homolog (mouse) |
| Alias Symbols |
ZNF475 |
| Peptide Sequence |
Synthetic peptide located within the following region: SNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Chowdhury,K., et al., (1989) Nucleic Acids Res. 17 (24), 10427-10438 |
| Description of Target |
ZFP1 is part of a large family of genes present in many organisms including yeast and human. Some of them are transcriptional activators and bind specifically to DNA by zinc mediated folded structures commonly known as zinc fingers. |
| Protein Interactions |
UBC; CBX5; HDAC2; Trim28; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZFP1 (ARP31586_T100) antibody |
| Blocking Peptide |
For anti-ZFP1 (ARP31586_T100) antibody is Catalog # AAP31586 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP1 |
| Uniprot ID |
Q6P2D0-2 |
| Protein Name |
Zinc finger protein 1 homolog |
| Protein Accession # |
NP_710155 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_153688 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZFP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 86%; Human: 100%; Mouse: 79%; Rat: 86% |
| Image 1 | Human Jurkat
 | Jurkat Whole Cell |
|
| Image 2 | Human Intestine
 | Rabbit Anti-ZFP1 Antibody
Catalog Number: ARP31586
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 3 | Human Spermatophore
 | Rabbit Anti-ZFP1 Antibody
Catalog Number: ARP31586
Paraffin Embedded Tissue: Human Spermatophore
Cellular Data: Epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
