ZFP1 antibody - N-terminal region (ARP31586_T100)
Data Sheet
Product Number ARP31586_T100
Product Page www.avivasysbio.com/zfp1-antibody-n-terminal-region-arp31586-t100.html
Product Name ZFP1 antibody - N-terminal region (ARP31586_T100)
Size 100 ul
Gene Symbol ZFP1
Alias Symbols ZNF475
Protein Size (# AA) 352 amino acids
Molecular Weight 41kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 162239
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger protein 1 homolog (mouse)
Description This is a rabbit polyclonal antibody against ZFP1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: SNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAI
Target Reference Chowdhury,K., et al., (1989) Nucleic Acids Res. 17 (24), 10427-10438
Description of Target ZFP1 is part of a large family of genes present in many organisms including yeast and human. Some of them are transcriptional activators and bind specifically to DNA by zinc mediated folded structures commonly known as zinc fingers.
Protein Interactions UBC; CBX5; HDAC2; Trim28;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZFP1 (ARP31586_T100) antibody is Catalog # AAP31586
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP1
Complete computational species homology data Anti-ZFP1 (ARP31586_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZFP1.
Swissprot Id Q6P2D0-2
Protein Name Zinc finger protein 1 homolog
Protein Accession # NP_710155
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZFP1.
Nucleotide Accession # NM_153688
Replacement Item This antibody may replace item sc-107322 from Santa Cruz Biotechnology.
Conjugation Options

ARP31586_T100-FITC Conjugated

ARP31586_T100-HRP Conjugated

ARP31586_T100-Biotin Conjugated

CB Replacement sc-107322; sc-107325
Species Reactivity Cow, Dog, Human, Mouse, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 86%; Human: 100%; Mouse: 79%; Rat: 86%
Image 1
Human Intestine
Rabbit Anti-ZFP1 Antibody
Catalog Number: ARP31586
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Spermatophore
Rabbit Anti-ZFP1 Antibody
Catalog Number: ARP31586
Paraffin Embedded Tissue: Human Spermatophore
Cellular Data: Epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Jurkat
Jurkat Whole Cell

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com