| Product Number |
ARP30889_P050 |
| Product Page |
www.avivasysbio.com/th-antibody-n-terminal-region-arp30889-p050.html |
| Name |
TH Antibody - N-terminal region (ARP30889_P050) |
| Protein Size (# AA) |
528 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
7054 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tyrosine hydroxylase |
| Alias Symbols |
TYH, DYT14, DYT5b |
| Peptide Sequence |
Synthetic peptide located within the following region: GAPGPSLTGSPWPGTAAPAASYTPTPRSPRFIGRRQSLIEDARKEREAAV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sutherland,G., Am. J. Med. Genet. B Neuropsychiatr. Genet. 147B (4), 495-499 |
| Description of Target |
The specific function of the protein remains unknown. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
| Protein Interactions |
TYSND1; YWHAQ; MAPKAPK2; CDK11B; RPS6KA5; CAMK2G; MAPK3; PRKACA; YWHAB; YWHAZ; MAPK1; SNCA; CSNK2A1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TH (ARP30889_P050) antibody |
| Blocking Peptide |
For anti-TH (ARP30889_P050) antibody is Catalog # AAP30889 (Previous Catalog # AAPP01612) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the n terminal region of human TH |
| Uniprot ID |
P07101 |
| Protein Name |
Tyrosine 3-monooxygenase |
| Protein Accession # |
NP_954986 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_199292 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TH |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Testis
 | Rabbit Anti-TH Antibody
Catalog Number: ARP30889_P050
Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
| | Image 2 | Human Small Intestine
 | WB Suggested Anti-TH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine |
|
|
