| Product Number |
ARP30655_P050 |
| Product Page |
www.avivasysbio.com/lipg-antibody-middle-region-arp30655-p050.html |
| Name |
LIPG Antibody - middle region (ARP30655_P050) |
| Protein Size (# AA) |
500 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
9388 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Lipase, endothelial |
| Alias Symbols |
EL, EDL, PRO719 |
| Peptide Sequence |
Synthetic peptide located within the following region: VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Willer,C.J., (2008) Nat. Genet. 40 (2), 161-169 |
| Description of Target |
LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
LIPG; EXOSC5; FANCA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LIPG (ARP30655_P050) antibody |
| Additional Information |
IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml. |
| Blocking Peptide |
For anti-LIPG (ARP30655_P050) antibody is Catalog # AAP30655 (Previous Catalog # AAPP01312) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LIPG |
| Uniprot ID |
Q9Y5X9 |
| Protein Name |
Endothelial lipase |
| Protein Accession # |
NP_006024 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006033 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LIPG |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 77%; Rabbit: 100%; Rat: 82%; Sheep: 100% |
| Image 1 | Human MCF7
 | WB Suggested Anti-LIPG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate |
| | Image 2 | Human Placenta
 | Placenta |
|
|
