L3MBTL2 Antibody - C-terminal region (ARP30080_T100)

Data Sheet
 
Product Number ARP30080_T100
Product Page www.avivasysbio.com/l3mbtl2-antibody-c-terminal-region-arp30080-t100.html
Name L3MBTL2 Antibody - C-terminal region (ARP30080_T100)
Protein Size (# AA) 705 amino acids
Molecular Weight 79kDa
NCBI Gene Id 83746
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name L(3)mbt-like 2 (Drosophila)
Alias Symbols L3MBT, H-l(3)mbt-l
Peptide Sequence Synthetic peptide located within the following region: EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Collins,J.E., Genome Biol. 5 (10), R84 (2004)
Description of Target L3MBTL2 contains 1 FCS-type zinc finger and 4 MBT repeats. It is putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis.
Protein Interactions TRIM42; STAC3; PHF10; TBC1D9B; PAICS; AES; SUMO2; SUMO1; PIAS1; HIST1H4A; HIST1H3A; RNF2; MPP3; PCGF6; RYBP; YAF2; SMARCAD1; HIST4H4; CBX3; HIST3H3; E2F6; Lin54; HDAC3; MEAF6; STAM2; RB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-L3MBTL2 (ARP30080_T100) antibody
Blocking Peptide For anti-L3MBTL2 (ARP30080_T100) antibody is Catalog # AAP30080 (Previous Catalog # AAPH00256)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human L3MBTL2
Uniprot ID Q969R5
Protein Name Lethal(3)malignant brain tumor-like protein 2
Protein Accession # NP_113676
Purification Protein A purified
Nucleotide Accession # NM_031488
Tested Species Reactivity Human
Gene Symbol L3MBTL2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 80%; Rabbit: 100%; Rat: 86%
Image 1
Human kidney
Rabbit Anti-L3MBTL2 Antibody
Catalog Number: ARP30080
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Transfected 293T
WB Suggested Anti-L3MBTL2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com