Search Antibody, Protein, and ELISA Kit Solutions

ZSCAN12 Antibody - N-terminal region (ARP39130_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39130_P050-FITC Conjugated

ARP39130_P050-HRP Conjugated

ARP39130_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ZSCAN12
Official Gene Full Name:
zinc finger and SCAN domain containing 12
NCBI Gene Id:
9753
Protein Name:
zinc finger and SCAN domain-containing protein 12
Swissprot Id:
O43309
Protein Accession #:
NP_055539
Alias Symbols:
ZFP96, ZNF96, ZNF305, ZNF29K1, dJ29K1.2
Protein Size (# AA):
604
Molecular Weight:
66kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZSCAN12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZSCAN12.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC12
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGPREALSR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRTAP10-1; SSX2IP; ZNF496; CEP70; ZKSCAN7; ZSCAN32; ZNF473; TFIP11; MTUS2; MID2; ZSCAN12; SUMO1;
Blocking Peptide:
For anti-ZSCAN12 (ARP39130_P050) antibody is Catalog # AAP39130
Datasheets/Manuals:
Printable datasheet for anti-ZSCAN12 (ARP39130_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...