Search Antibody, Protein, and ELISA Kit Solutions

ZSCAN12 Antibody - N-terminal region (ARP39130_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39130_P050-FITC Conjugated

ARP39130_P050-HRP Conjugated

ARP39130_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
zinc finger and SCAN domain containing 12
NCBI Gene Id:
Protein Name:
zinc finger and SCAN domain-containing protein 12
Swissprot Id:
Protein Accession #:
Alias Symbols:
ZFP96, ZNF96, ZNF305, ZNF29K1, dJ29K1.2
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZSCAN12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZSCAN12.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZSC12
Peptide Sequence:
Synthetic peptide located within the following region: LEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFRQFCYQETSGPREALSR
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZSCAN12 (ARP39130_P050) antibody is Catalog # AAP39130
Printable datasheet for anti-ZSCAN12 (ARP39130_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...