ZNF768 Antibody - N-terminal region : FITC (ARP58118_P050-FITC)

Catalog No: ARP58118_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Rat, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF768
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 91%; Human: 100%; Pig: 92%; Rat: 75%
• Peptide Sequence: Synthetic peptide located within the following region: DSQSPEFESQSPRYEPQSPGYEPRSPGYEPRSPGYESESSRYESQNTELK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF768 (ARP58118_P050-FITC) antibody is Catalog # AAP58118 (Previous Catalog # AAPP32551)
• Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Target Info

• Gene Symbol: ZNF768
• Gene Full Name: Zinc finger protein 768
• Alias Symbols: FLJ23436
• NCBI Gene Id: 79724
• Protein Name: Zinc finger protein 768
• Description of Target: ZNF768 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
• Uniprot ID: Q9H5H4
• Protein Accession #: NP_078947
• Nucleotide Accession #: NM_024671
• Protein Size (# AA): 540
• Molecular Weight: 60kDa
• Protein Interactions: PASK; MDC1; BARD1; UBC; TNNT1; NDUFA12; HMP19; ZNF277;