ZNF74 Antibody - middle region (ARP35666_P050)

Catalog No: ARP35666_P050

WB Suggested Anti-ZNF74 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysateZNF74 is supported by BioGPS gene expression data to be expressed in HEK293T

Rabbit Anti-ZNF74 antibody
Catalog Number: ARP35666_P050
Paraffin Embedded Tissue: Human Brain cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF74
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGKAFRQSSSLTL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF74 (ARP35666_P050) antibody is Catalog # AAP35666 (Previous Catalog # AAPP06912)
• Sample Type Confirmation:

  ZNF74 is supported by BioGPS gene expression data to be expressed in HEK293T

• Reference: Collins,J.E., Genome Biol. 5 (10), R84 (2004)

Target Info

• Gene Symbol: ZNF74
• Gene Full Name: Zinc finger protein 74
• Alias Symbols: COS52, hZNF7, ZFP520, ZNF520
• NCBI Gene Id: 7625
• Protein Name: Zinc finger protein 74
• Description of Target: ZNF74 contains 1 KRAB domain. The exact function of ZNF74 is not known.
• Uniprot ID: Q6PJP1
• Protein Accession #: NP_003417
• Nucleotide Accession #: NM_003426
• Protein Size (# AA): 644
• Molecular Weight: 72kDa
• Protein Interactions: HSP90AA1; UBC; POLR2A; TRIM28;