Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZNF599 antibody - N-terminal region (ARP50349_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP50349_P050-FITC Conjugated

ARP50349_P050-HRP Conjugated

ARP50349_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ZNF599
NCBI Gene Id:
148103
Official Gene Full Name:
Zinc finger protein 599
Protein Name:
Zinc finger protein 599
Swissprot Id:
Q96NL3
Protein Accession #:
NP_001007249
Nucleotide Accession #:
NM_001007248
Alias Symbols:
-
Description of Target:
ZNF599 may be involved in transcriptional regulation.
Protein Size (# AA):
588
Molecular Weight:
67kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF599.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF599.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF599
Species Reactivity:
Cow, Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Human: 100%
Complete computational species homology data:
Anti-ZNF599 (ARP50349_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NDEL1; TSGA10; MTUS2; UBC;
Blocking Peptide:
For anti-ZNF599 (ARP50349_P050) antibody is Catalog # AAP50349 (Previous Catalog # AAPP13621)
Datasheets/Manuals:
Printable datasheet for anti-ZNF599 (ARP50349_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...