Catalog No: ARP37815_T100
Price: $0.00
SKU
ARP37815_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ZNF441 Antibody - N-terminal region (ARP37815_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ZNF441 (ARP37815_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZNF441
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-ZNF441 (ARP37815_T100)
Peptide SequenceSynthetic peptide located within the following region: MVERACEIKDNSQCGGPFTQTQDSIVNEKIPGVDPWESSECTDVLMGRSS
Concentration1.0 mg/ml
Blocking PeptideFor anti-ZNF441 (ARP37815_T100) antibody is Catalog # AAP37815 (Previous Catalog # AAPS05212)
ReferenceIsogai,T. Unpublished (2002)
Gene SymbolZNF441
Gene Full NameZinc finger protein 441
NCBI Gene Id126068
Protein NameZinc finger protein 441
Description of TargetZNF441 contains 19 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation.
Swissprot IdQ8N8Z8
Protein Accession #NP_689568
Nucleotide Accession #NM_152355
Protein Size (# AA)626
Molecular Weight72kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ZNF441.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ZNF441.
Protein InteractionsUBC;
  1. What is the species homology for "ZNF441 Antibody - N-terminal region (ARP37815_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "ZNF441 Antibody - N-terminal region (ARP37815_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZNF441 Antibody - N-terminal region (ARP37815_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZNF441 Antibody - N-terminal region (ARP37815_T100)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "ZNF441 Antibody - N-terminal region (ARP37815_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZNF441 Antibody - N-terminal region (ARP37815_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZNF441 Antibody - N-terminal region (ARP37815_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "72kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZNF441 Antibody - N-terminal region (ARP37815_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ZNF441"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZNF441"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZNF441"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZNF441"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZNF441"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZNF441"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZNF441 Antibody - N-terminal region (ARP37815_T100)
Your Rating