Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZNF419 antibody - N-terminal region (ARP39606_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP39606_P050-FITC Conjugated

ARP39606_P050-HRP Conjugated

ARP39606_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ZNF419
NCBI Gene Id:
79744
Official Gene Full Name:
Zinc finger protein 419
Protein Name:
Zinc finger protein 419
Swissprot Id:
Q96HQ0
Protein Accession #:
NP_078967
Nucleotide Accession #:
NM_024691
Alias Symbols:
FLJ23233, ZNF419A
Description of Target:
ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. NF419A may be involved in transcriptional regulation.
Protein Size (# AA):
510
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF419.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF419.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF419
Species Reactivity:
Cow, Horse, Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Horse: 83%; Human: 100%
Complete computational species homology data:
Anti-ZNF419 (ARP39606_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRTAP10-7; UBC;
Blocking Peptide:
For anti-ZNF419 (ARP39606_P050) antibody is Catalog # AAP39606 (Previous Catalog # AAPP23092)
Datasheets/Manuals:
Printable datasheet for anti-ZNF419 (ARP39606_P050) antibody
Sample Type Confirmation:

ZNF419 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Tell us what you think about this item!

Write A Review
    Please, wait...