Search Antibody, Protein, and ELISA Kit Solutions

ZNF358 Antibody - N-terminal region (ARP57958_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57958_P050-FITC Conjugated

ARP57958_P050-HRP Conjugated

ARP57958_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ZNF358
Official Gene Full Name:
zinc finger protein 358
NCBI Gene Id:
140467
Protein Name:
Zinc finger protein 358
Swissprot Id:
Q9NW07
Protein Accession #:
XP_005272517
Alias Symbols:
ZNF358,
Description of Target:
ZNF358 may be involved in transcriptional regulation.
Protein Size (# AA):
568
Molecular Weight:
62kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF358.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF358.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF358
Predicted Species Reactivity:
Guinea Pig, Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 85%; Human: 100%
Complete computational species homology data:
Anti-ZNF358 (ARP57958_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EDLNTVPEDVDPSYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLDPD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-ZNF358 (ARP57958_P050) antibody is Catalog # AAP57958
Datasheets/Manuals:
Printable datasheet for anti-ZNF358 (ARP57958_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...