Search Antibody, Protein, and ELISA Kit Solutions

ZNF35 Antibody - N-terminal region (ARP35662_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35662_P050-FITC Conjugated

ARP35662_P050-HRP Conjugated

ARP35662_P050-Biotin Conjugated

Gene Symbol:
ZNF35
Official Gene Full Name:
zinc finger protein 35
NCBI Gene Id:
7584
Protein Name:
Zinc finger protein 35
Swissprot Id:
P13682
Protein Accession #:
XP_005265501
Alias Symbols:
ZNF35,
Replacement Item:
This antibody may replace item sc-376972 from Santa Cruz Biotechnology.
Description of Target:
ZNF35 may be involved in transcriptional regulation. It is involved in cell differentiation and/or proliferation.
Protein Size (# AA):
527
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF35.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF35.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF35
Predicted Species Reactivity:
Horse, Human, Pig
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Horse: 79%; Human: 100%; Pig: 86%
Complete computational species homology data:
Anti-ZNF35 (ARP35662_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
APP; CREB1; CDC5L;
Blocking Peptide:
For anti-ZNF35 (ARP35662_P050) antibody is Catalog # AAP35662
Datasheets/Manuals:
Printable datasheet for anti-ZNF35 (ARP35662_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...