Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP35662_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35662_P050-FITC Conjugated

ARP35662_P050-HRP Conjugated

ARP35662_P050-Biotin Conjugated

ZNF35 Antibody - N-terminal region (ARP35662_P050)

Catalog#: ARP35662_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHorse, Human, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-376972 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF35
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceHorse: 79%; Human: 100%; Pig: 86%
Complete computational species homology dataAnti-ZNF35 (ARP35662_P050)
Peptide SequenceSynthetic peptide located within the following region: GQASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQ
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ZNF35 (ARP35662_P050) antibody is Catalog # AAP35662
Datasheets/ManualsPrintable datasheet for anti-ZNF35 (ARP35662_P050) antibody
Target ReferenceN/A
Gene SymbolZNF35
Official Gene Full Namezinc finger protein 35
Alias SymbolsZNF35,
NCBI Gene Id7584
Protein NameZinc finger protein 35
Description of TargetZNF35 may be involved in transcriptional regulation. It is involved in cell differentiation and/or proliferation.
Swissprot IdP13682
Protein Accession #XP_005265501
Protein Size (# AA)527
Molecular Weight57kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ZNF35.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ZNF35.
Protein InteractionsAPP; CREB1; CDC5L;
Write Your Own Review
You're reviewing:ZNF35 Antibody - N-terminal region (ARP35662_P050)
Your Rating
Aviva Live Chat
Assay Development
Aviva Tips and Tricks
Aviva Travel Grant