Catalog No: ARP51610_P050
Price: $0.00
SKU
ARP51610_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for ARP51610_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZNF33A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%; Sheep: 86%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP51610 (Previous Catalog # AAPP30116)
Gene SymbolZNF33A
Gene Full NameZinc finger protein 33A
Alias SymbolsKOX2, KOX5, KOX31, NF11A, ZNF11, ZNF33, ZZAPK, ZNF11A
NCBI Gene Id7581
Protein NameZinc finger protein 33A
Description of TargetZNF33A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF33A may be involved in transcriptional regulation.
Uniprot IDQ06730
Protein Accession #EAW85891
Nucleotide Accession #NM_006954
Protein Size (# AA)733
Molecular Weight80kDa
Protein InteractionsCDK11A; CBX6; ZAK; ZNF33A;
  1. What is the species homology for "ZNF33A Antibody - middle region (ARP51610_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "ZNF33A Antibody - middle region (ARP51610_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZNF33A Antibody - middle region (ARP51610_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZNF33A Antibody - middle region (ARP51610_P050)"?

    This target may also be called "KOX2, KOX5, KOX31, NF11A, ZNF11, ZNF33, ZZAPK, ZNF11A" in publications.

  5. What is the shipping cost for "ZNF33A Antibody - middle region (ARP51610_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZNF33A Antibody - middle region (ARP51610_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZNF33A Antibody - middle region (ARP51610_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "80kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZNF33A Antibody - middle region (ARP51610_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ZNF33A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZNF33A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZNF33A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZNF33A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZNF33A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZNF33A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZNF33A Antibody - middle region (ARP51610_P050)
Your Rating