Search Antibody, Protein, and ELISA Kit Solutions

ZNF3 antibody - N-terminal region (ARP33506_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33506_P050-FITC Conjugated

ARP33506_P050-HRP Conjugated

ARP33506_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Zinc finger protein 3
Protein Name:
Zinc finger protein 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
A8-51, FLJ20216, HF.12, KOX25, PP838, Zfp113
Replacement Item:
This antibody may replace item sc-113059 from Santa Cruz Biotechnology.
Description of Target:
ZNF3 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF3 is involved in cell differentiation and/or proliferation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF3.
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF3
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Goat: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%
Complete computational species homology data:
Anti-ZNF3 (ARP33506_P050)
Peptide Sequence:
Synthetic peptide located within the following region: METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQEL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ZNF3 (ARP33506_P050) antibody is Catalog # AAP33506 (Previous Catalog # AAPP04557)
Printable datasheet for anti-ZNF3 (ARP33506_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...