ZNF280B Antibody - N-terminal region (ARP32237_P050)

Catalog No: ARP32237_P050

WB Suggested Anti-ZNF280B Antibody
Titration: 1.0 ug/ml
Positive Control: ACHN Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Goat, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Goat: 90%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EEEKEPEPQKNIQETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF280B (ARP32237_P050) antibody is Catalog # AAP32237

Target Info

• Gene Symbol: ZNF280B
• Gene Full Name: Zinc finger protein 280B
• Alias Symbols: SUHW2, ZNF279, ZNF632, 5'OY11.1, D87009.C22.3
• NCBI Gene Id: 140883
• Protein Name: Zinc finger protein 280B
• Description of Target: ZNF280B contains 4 C2H2-type zinc fingers. It may function as a transcription factor.
• Uniprot ID: Q86YH2
• Protein Accession #: NP_542942
• Nucleotide Accession #: NM_080764
• Protein Size (# AA): 543
• Molecular Weight: 61kDa
• Protein Interactions: PAXIP1; ELAVL1;