ZNF24 Antibody - N-terminal region : HRP (ARP33518_P050-HRP)

Catalog No: ARP33518_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF24
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF24 (ARP33518_P050-HRP) antibody is Catalog # AAP33518
• Reference: N/A

Target Info

• Gene Symbol: ZNF24
• Gene Full Name: zinc finger protein 24
• Alias Symbols: KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191
• NCBI Gene Id: 7572
• Protein Name: Zinc finger protein 24
• Description of Target: ZNF24 is a transcription factor required for myelination of differentiated oligodendrocytes. It is required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), it is involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically binds to the 5'-TCAT-3' DNA sequence (By similarity). It has transcription repressor activity in vitro.
• Uniprot ID: P17028
• Protein Size (# AA): 368
• Molecular Weight: 40kDa
• Protein Interactions: DDX6; MID2; FAM115A; DZIP3; ZSCAN21; LMO2; ZNF396; ZNF483; PGBD1; ZNF446; ZSCAN32; SEC62; HMGB1; APLP1; PPP1CC; ERCC8; OR8B2; YY1; PSMA2; MZF1; SUMO1; SUMO2; SMARCAD1; UBC; SOX2; ZNHIT3; TRIM25; KBTBD7; USP11; LRIF1; KIAA1377; COPS6; SCAND1; RBM48; ZBTB16