Search Antibody, Protein, and ELISA Kit Solutions

ZNF24 Antibody - N-terminal region (ARP33518_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33518_P050-FITC Conjugated

ARP33518_P050-HRP Conjugated

ARP33518_P050-Biotin Conjugated

Gene Symbol:
ZNF24
Official Gene Full Name:
zinc finger protein 24
NCBI Gene Id:
7572
Protein Name:
Zinc finger protein 24
Swissprot Id:
P17028
Alias Symbols:
ZNF24, KOX17, ZNF191, ZSCAN3,
Replacement Item:
This antibody may replace item sc-101079 from Santa Cruz Biotechnology.
Description of Target:
ZNF24 is a transcription factor required for myelination of differentiated oligodendrocytes. It is required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), it is involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically binds to the 5'-TCAT-3' DNA sequence (By similarity). It has transcription repressor activity in vitro.
Protein Size (# AA):
368
Molecular Weight:
40kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF24.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF24.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF24
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-ZNF24 (ARP33518_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DDX6; MID2; FAM115A; DZIP3; ZSCAN21; LMO2; ZNF396; ZNF483; PGBD1; ZNF446; ZSCAN32; SEC62; HMGB1; APLP1; PPP1CC; ERCC8; OR8B2; YY1; PSMA2; MZF1; SUMO1; SUMO2; SMARCAD1; UBC; SOX2; ZNHIT3; TRIM25; KBTBD7; USP11; LRIF1; KIAA1377; COPS6; SCAND1; RBM48; ZBTB16
Blocking Peptide:
For anti-ZNF24 (ARP33518_P050) antibody is Catalog # AAP33518
Datasheets/Manuals:
Printable datasheet for anti-ZNF24 (ARP33518_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...