Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZNF236 antibody - middle region (ARP33556_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP33556_P050-FITC Conjugated

ARP33556_P050-HRP Conjugated

ARP33556_P050-Biotin Conjugated

Gene Symbol:
ZNF236
NCBI Gene Id:
7776
Official Gene Full Name:
Zinc finger protein 236
Protein Name:
Zinc finger protein 236
Swissprot Id:
Q9UL36
Protein Accession #:
NP_031371
Nucleotide Accession #:
NM_007345
Alias Symbols:
ZNF236A, ZNF236B
Replacement Item:
This antibody may replace item sc-85227 from Santa Cruz Biotechnology.
Description of Target:
ZNF236 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 30 C2H2-type zinc fingers. ZNF236 may be involved in transcriptional regulation.
Protein Size (# AA):
1845
Molecular Weight:
204kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF236.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF236.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ZNF236
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ZNF236 (ARP33556_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-ZNF236 (ARP33556_P050) antibody is Catalog # AAP33556 (Previous Catalog # AAPP04611)
Datasheets/Manuals:
Printable datasheet for anti-ZNF236 (ARP33556_P050) antibody
Sample Type Confirmation:

ZNF236 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Halama,N., (2003) Genomics 82 (3), 406-411

Tell us what you think about this item!

Write A Review
    Please, wait...