Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP33556_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33556_P050-FITC Conjugated

ARP33556_P050-HRP Conjugated

ARP33556_P050-Biotin Conjugated

ZNF236 Antibody - middle region (ARP33556_P050)

Catalog#: ARP33556_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-85227 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF236
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-ZNF236 (ARP33556_P050)
Peptide Sequence Synthetic peptide located within the following region: VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ZNF236 (ARP33556_P050) antibody is Catalog # AAP33556 (Previous Catalog # AAPP04611)
Datasheets/Manuals Printable datasheet for anti-ZNF236 (ARP33556_P050) antibody
Sample Type Confirmation

ZNF236 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Halama,N., (2003) Genomics 82 (3), 406-411
Gene Symbol ZNF236
Official Gene Full Name Zinc finger protein 236
Alias Symbols ZNF236A, ZNF236B
NCBI Gene Id 7776
Protein Name Zinc finger protein 236
Description of Target ZNF236 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 30 C2H2-type zinc fingers. ZNF236 may be involved in transcriptional regulation.
Swissprot Id Q9UL36
Protein Accession # NP_031371
Nucleotide Accession # NM_007345
Protein Size (# AA) 1845
Molecular Weight 204kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZNF236.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZNF236.
Protein Interactions UBC;
  1. What is the species homology for "ZNF236 Antibody - middle region (ARP33556_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "ZNF236 Antibody - middle region (ARP33556_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZNF236 Antibody - middle region (ARP33556_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZNF236 Antibody - middle region (ARP33556_P050)"?

    This target may also be called "ZNF236A, ZNF236B" in publications.

  5. What is the shipping cost for "ZNF236 Antibody - middle region (ARP33556_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZNF236 Antibody - middle region (ARP33556_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZNF236 Antibody - middle region (ARP33556_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "204kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZNF236 Antibody - middle region (ARP33556_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ZNF236"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZNF236"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZNF236"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZNF236"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZNF236"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZNF236"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZNF236 Antibody - middle region (ARP33556_P050)
Your Rating
We found other products you might like!