ZNF160 Antibody - N-terminal region : FITC (ARP51704_P050-FITC)

Catalog No: ARP51704_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZN160
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: QVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZNF160 (ARP51704_P050-FITC) antibody is Catalog # AAP51704

Target Info

• Gene Symbol: ZNF160
• Gene Full Name: zinc finger protein 160
• Alias Symbols: F11, HZF5, KR18, HKr18
• NCBI Gene Id: 90338
• Protein Name: zinc finger protein 160
• Description of Target: The protein encoded by this gene is a Kruppel-related zinc finger protein which is characterized by the presence of an N-terminal repressor domain, the Kruppel-associated box (KRAB). The KRAB domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Multiple transcript variants have been found for this gene.
• Uniprot ID: Q9HCG1
• Protein Accession #: XP_006723525
• Protein Size (# AA): 818
• Molecular Weight: 89kDa
• Protein Interactions: RCHY1; LAMC3; UBC;