Search Antibody, Protein, and ELISA Kit Solutions

ZNF157 Antibody - N-terminal region (ARP38343_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38343_P050-FITC Conjugated

ARP38343_P050-HRP Conjugated

ARP38343_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Zinc finger protein 157
NCBI Gene Id:
Protein Name:
Zinc finger protein 157
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
ZNF157 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF157 may be involved in transcriptional regulation. This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-28 U28687.1 19-46 29-1620 BC075003.2 1-1592 1621-1695 CO245585.1 27-101 c
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF157.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF157.
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF157
Predicted Species Reactivity:
Horse, Human, Pig
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Horse: 93%; Human: 100%; Pig: 86%
Complete computational species homology data:
Anti-ZNF157 (ARP38343_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEWHRLDPAQRTM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ZNF157 (ARP38343_P050) antibody is Catalog # AAP38343 (Previous Catalog # AAPP23134)
Printable datasheet for anti-ZNF157 (ARP38343_P050) antibody
Target Reference:
Ross,M.T., (2005) Nature 434 (7031), 325-337

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...