Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34536_P050-FITC Conjugated

ARP34536_P050-HRP Conjugated

ARP34536_P050-Biotin Conjugated

ZNF148 Antibody - middle region (ARP34536_P050)

Catalog#: ARP34536_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZNF148
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-ZNF148 (ARP34536_P050)
Peptide SequenceSynthetic peptide located within the following region: QHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ZNF148 (ARP34536_P050) antibody is Catalog # AAP34536 (Previous Catalog # AAPP06008)
Datasheets/ManualsPrintable datasheet for anti-ZNF148 (ARP34536_P050) antibody
Target ReferenceChupreta,S., (2007) J. Biol. Chem. 282 (50), 36155-36166

Hemida, M. G. et al. MicroRNA-203 enhances coxsackievirus B3 replication through targeting zinc finger protein-148. Cell. Mol. Life Sci. 70, 277-91 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22842794

Gene SymbolZNF148
Official Gene Full NameZinc finger protein 148
Alias SymbolsBERF-1, BFCOL1, HT-BETA, ZBP-89, ZFP148, pHZ-52
NCBI Gene Id7707
Protein NameZinc finger protein 148
Description of TargetZNF148 is involved in transcriptional regulation. ZNF148 represses the transcription of a number of genes including gastrin, stromelysin and enolase. ZNF148 binds to the G-rich box in the enhancer region of these genes.
Swissprot IdQ9UQR1
Protein Accession #NP_068799
Nucleotide Accession #NM_021964
Protein Size (# AA)794
Molecular Weight89kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ZNF148.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ZNF148.
Protein InteractionsCCDC67; CEP70; NUTM2F; GORASP2; GLRX3; TRIM10; SIAH1; KRT31; SUMO1; UBC; NOC4L; ZNF316; TRRAP; KAT2A; EP300; ELAVL1; SUMO2; HDAC1; HDAC3; PTRF; TP53; STAT3;
  1. What is the species homology for "ZNF148 Antibody - middle region (ARP34536_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "ZNF148 Antibody - middle region (ARP34536_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZNF148 Antibody - middle region (ARP34536_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ZNF148 Antibody - middle region (ARP34536_P050)"?

    This target may also be called "BERF-1, BFCOL1, HT-BETA, ZBP-89, ZFP148, pHZ-52" in publications.

  5. What is the shipping cost for "ZNF148 Antibody - middle region (ARP34536_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZNF148 Antibody - middle region (ARP34536_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "ZNF148 Antibody - middle region (ARP34536_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "89kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZNF148 Antibody - middle region (ARP34536_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ZNF148"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZNF148"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZNF148"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZNF148"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZNF148"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZNF148"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZNF148 Antibody - middle region (ARP34536_P050)
Your Rating
Aviva Tips and Tricks
Assay Development
Aviva Validation Data
Aviva Live Chat